PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g032180.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 288aa    MW: 31669.5 Da    PI: 5.0201
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g032180.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB39.21.7e-12152199251
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseas 51 
                         +eqd+++P  nv+rim+ + P +  is+d k+t+ +c+sefi fvt e++
  Solyc02g032180.1.1 152 QEQDQVIP--NVARIMHSTHPPHIMISDDVKQTMYHCISEFICFVTYETN 199
                         57888877..************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.74E-6134199IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.6E-9151199IPR009072Histone-fold
PfamPF008083.9E-7160199IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MEALDHFSKV TALMADLDKS NIFIAGVGEA VKQNIRLTTG FSVGTHPIKY LGLPLTSKNV  60
ANGTLLQSGN SCGKLLSKKH IPYKESFERE VYLYRQSEMD NGNHVGGSGN GGFHSYHRSP  120
QPTSVDPPSL DMEMSLELPA HLNQEVVEII IQEQDQVIPN VARIMHSTHP PHIMISDDVK  180
QTMYHCISEF ICFVTYETNA FEDDGGECRS HTRESLLKRP MVDTASSSNI TPYNLPPIFP  240
MAHDHFFFSP PMGNGDIQGD APNGSTSQCA VASMDSDVES PKEEDKE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2040829e-79Solanum lycopersicum cv. Heinz 1706, chromosome 5 BAC clone C05SLe0086I08, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015075904.11e-105PREDICTED: nuclear transcription factor Y subunit B-6-like
TrEMBLK4B5G40.0K4B5G4_SOLLC; Uncharacterized protein
STRINGSolyc02g032180.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2669322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.13e-09NF-YB family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]